


| Basic Information | |
|---|---|
| Taxon OID | 3300031398 Open in IMG/M |
| Scaffold ID | Ga0307979_1001147 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1058 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 18836 |
| Total Scaffold Genes | 26 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (19.23%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica: Organic Lake | |||||||
| Coordinates | Lat. (o) | -68.457 | Long. (o) | 78.1911 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002954 | Metagenome | 517 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307979_10011475 | F002954 | N/A | MIQEGEGHWPNSSKKLQKARNLWVLRTPQNNEEEGARAKKLVTCGTRISLGRGQSVPFSAQGAYCSAPEP |
| ⦗Top⦘ |