


| Basic Information | |
|---|---|
| Taxon OID | 3300031226 Open in IMG/M |
| Scaffold ID | Ga0307497_10001524 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5788 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (55.56%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Washington | |||||||
| Coordinates | Lat. (o) | 46.0356 | Long. (o) | -122.86 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F094342 | Metagenome / Metatranscriptome | 106 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307497_100015245 | F094342 | GGA | MAKVLTQDEALRLASNIARTRNLSARDSSKTPSKPANELEGLIRDKLPDPVRRHLIDVIIDHIAADGLAANWTAQPVWSHEVSNNDRGEFIRAMFQVLRDYDLLTDD |
| ⦗Top⦘ |