


| Basic Information | |
|---|---|
| Taxon OID | 3300031037 Open in IMG/M |
| Scaffold ID | Ga0073979_12285413 Open in IMG/M |
| Source Dataset Name | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 573 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Atlantic ocean | |||||||
| Coordinates | Lat. (o) | -38.0 | Long. (o) | -45.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042729 | Metatranscriptome | 157 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0073979_122854131 | F042729 | N/A | ISGHNMNKYLSLCLLVSSSLAAPAADAEADPQFGFPVPAPLTVPAPNCVTTNELLVTQACTPRAENICETQVVETEEIEYEPLCIDVVDVICDAPVAPYAHGLGKREAEADPEADAQFLGYAAHAVAHSVKATVKHACREVTTEHCVDNPKIKLVPVEVEHCHTVTKVDCTPVENPIPTTKCEPVETTHV |
| ⦗Top⦘ |