NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0061014_12398797

Scaffold Ga0061014_12398797


Overview

Basic Information
Taxon OID3300030914 Open in IMG/M
Scaffold IDGa0061014_12398797 Open in IMG/M
Source Dataset NameCoassembly of Cow Y Corn Stover
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)510
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen → Fungi-Associated Bovine Rumen Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa, For Metatranscriptome Analysis

Source Dataset Sampling Location
Location NameUSA: Illinois
CoordinatesLat. (o)40.102108Long. (o)-88.227299Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016102Metagenome / Metatranscriptome249Y

Sequences

Protein IDFamilyRBSSequence
Ga0061014_123987971F016102N/AKINFPKINWTEEDQDLTPELSQEIHDSLKEVLDTITNKKSINPHLIQDGLRSINFHKERPDLYKIIEEMCLEYDLKGKEMNTSQILNYVINYLSDNKTRKGLNALFDEIKNRRTGEITPKELEKIAKDNEKPLDEKDFQFILKTISGHSDSININQDEFYYIMTKNPEE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.