NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187754_1072083

Scaffold Ga0187754_1072083


Overview

Basic Information
Taxon OID3300030669 Open in IMG/M
Scaffold IDGa0187754_1072083 Open in IMG/M
Source Dataset NameMetatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium under thermal stress from Pennsylvania, USA - 30_T1F_3236KB8 (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)599
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa

Source Dataset Sampling Location
Location NameUSA: Pennsylvania
CoordinatesLat. (o)40.7982Long. (o)-77.8599Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003026Metagenome / Metatranscriptome512Y

Sequences

Protein IDFamilyRBSSequence
Ga0187754_10720831F003026N/AVSVFARIGYSAAWMFITNFTHSLPWNEFLAQDPGRTWPVLHNVMAMVLGGKHRWNEMLFHDVHHAFPNAVGTLSQRGRFHGWEKVHDAAAEVLHRGLWKPNGDEETQMQKTQKKRSMMMQQGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.