NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210254_11374668

Scaffold Ga0210254_11374668


Overview

Basic Information
Taxon OID3300030602 Open in IMG/M
Scaffold IDGa0210254_11374668 Open in IMG/M
Source Dataset NameMetatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)647
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameCanada: Quebec
CoordinatesLat. (o)47.2719Long. (o)-71.2088Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001525Metagenome / Metatranscriptome678Y

Sequences

Protein IDFamilyRBSSequence
Ga0210254_113746682F001525N/AGQDMSAVILAVFSEYGAADRVRTQLVSDGFPTDRVELTASAEPGRAGSHPAPSAHARFSQYFRTLLSRPDEQQFVDALARRVEAGAATIAVHPRGTIETTRAADILENAGAVEVIGHDLGNQSAFERAAANGDGYWVRHFMLDNPTGADCIYCRLFPGHKH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.