


| Basic Information | |
|---|---|
| Taxon OID | 3300030585 Open in IMG/M |
| Scaffold ID | Ga0247639_1288467 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb4 (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 520 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Perkinsozoa → Perkinsea → Perkinsida → Perkinsidae → Perkinsus → Perkinsus marinus | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | France: Rollainville | |||||||
| Coordinates | Lat. (o) | 48.3625 | Long. (o) | 5.7397 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002418 | Metagenome / Metatranscriptome | 560 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247639_12884671 | F002418 | N/A | SIVFSDAGTVITVDIIGFFGNLPLSLWVGECATFDKCIKIWDNTQGCCGTNKNFQANITVDCQNTYPYLNNVKLSELTLDHFEITEKIVGININVKDITDNVEQAMSGLITQYLTTEAFINYNGTKITLLEFANIEIQTETHGFFECPTSNKQEIILL |
| ⦗Top⦘ |