NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247631_1074502

Scaffold Ga0247631_1074502


Overview

Basic Information
Taxon OID3300030550 Open in IMG/M
Scaffold IDGa0247631_1074502 Open in IMG/M
Source Dataset NameMetatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb8 (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)644
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameFrance: Rollainville
CoordinatesLat. (o)48.3625Long. (o)5.7397Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000243Metagenome / Metatranscriptome1476Y

Sequences

Protein IDFamilyRBSSequence
Ga0247631_10745021F000243N/ALLPEFAYPRTMTTLIPEFAHPQTITTLIPEFAQPNTGGVYMDRTVNTIQHITGKVTFDKGCTATDTYGSNKCTWDWKSSATASIDGALQEDITSGKLVVDLKINNVIPFSFSCPICGANCTFEIPIIKKPETFAMPPCPIKAETLSKNIPFTLPDKNPIGISASVTGTVQIADQSGGVIFKLSVNAKVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.