


| Basic Information | |
|---|---|
| Taxon OID | 3300030498 Open in IMG/M |
| Scaffold ID | Ga0268247_10073965 Open in IMG/M |
| Source Dataset Name | Agave microbial communities from Guanajuato, Mexico - Or.Ma.e (v2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1476 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guanajuato, Mexico | |||||||
| Coordinates | Lat. (o) | 21.0936 | Long. (o) | -100.2988 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079526 | Metagenome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0268247_100739651 | F079526 | AGGA | MSSSNYPNKKDKGKAVQKTEDYQLQIPTQNQFTPLTNFPPLPYKTAVTNHSSSNSTDAYIIRYTEHLLLTSCKPPPPTNIISSIIQKTVGPNHFATDDLRRTQKFYELILVDTNSVSITHTFDKYHPAQILYSKCIIKSVLNAQQWKQPFEECKF |
| ⦗Top⦘ |