


| Basic Information | |
|---|---|
| Taxon OID | 3300029946 Open in IMG/M |
| Scaffold ID | Ga0116648_115651 Open in IMG/M |
| Source Dataset Name | Baboon gut microbial communities from fecal samples in Kenya - M08 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Duke University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 695 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | 2.717 | Long. (o) | 37.1 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052660 | Metagenome | 142 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116648_1156511 | F052660 | AGGA | MRILRVLPENTPEKIGQERAGIEWTVVKSKIRLCIRNRSYGRFLHGGILMGIALPIPSHRAKSHDFACWWPAAAGHSRSADALPGKSNS |
| ⦗Top⦘ |