


| Basic Information | |
|---|---|
| Taxon OID | 3300029928 Open in IMG/M |
| Scaffold ID | Ga0116643_1000016 Open in IMG/M |
| Source Dataset Name | Baboon gut microbial communities from fecal samples in Kenya - M03 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Duke University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 152832 |
| Total Scaffold Genes | 279 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 73 (26.16%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | 2.717 | Long. (o) | 37.1 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063247 | Metagenome / Metatranscriptome | 129 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116643_100001611 | F063247 | N/A | MKKYPRTSTIEIDCDPCTGMGRQQNHYEAICKLLNVKPEPRISAFFGCWEWPITYKTAEDEAKAKEFLTDLYNSGLCRYASW |
| ⦗Top⦘ |