


| Basic Information | |
|---|---|
| Taxon OID | 3300029902 Open in IMG/M |
| Scaffold ID | Ga0247058_1006735 Open in IMG/M |
| Source Dataset Name | Cryconite microbial communities from ice sheet in Thule, Greenland - THU-2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DMAC, Technical University of Denmark |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5111 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (77.78%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Greenland: Thule | |||||||
| Coordinates | Lat. (o) | 76.23 | Long. (o) | -68.15 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056330 | Metagenome / Metatranscriptome | 137 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247058_10067355 | F056330 | AGAAGG | MPTDALLALQASVTKAATFNGAALILATGTPRRGLKARVIYSAATSTTTNACTFSLDVSYDAGSTWNSDFYQPIALALTTTAQSGEIFIPFEVSPTSVVNGIQIRLTATVSGGGVATITYQGDISLARP |
| ⦗Top⦘ |