


| Basic Information | |
|---|---|
| Taxon OID | 3300029892 Open in IMG/M |
| Scaffold ID | Ga0246235_101953 Open in IMG/M |
| Source Dataset Name | Fracture fluid microbial communities from borehole on the 26 level of Beatrix Gold Mine, Welkom, South Africa - Be326_2011_MF |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Princeton University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5207 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (62.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracture Fluid → Fracture Fluid Microbial Communities From Borehole On The 26 Level Of Beatrix Gold Mine, Welkom, South Africa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Africa: Welkom | |||||||
| Coordinates | Lat. (o) | -28.232288 | Long. (o) | 26.794365 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025775 | Metagenome | 200 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0246235_1019534 | F025775 | GGAG | MKQFLTFQGFPMVVVTALIVWAWISILSVLIASFF |
| ⦗Top⦘ |