| Basic Information | |
|---|---|
| Taxon OID | 3300029890 Open in IMG/M |
| Scaffold ID | Ga0246099_100525 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig2157 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, Berkeley |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 26138 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (73.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Atribacterota → Atribacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Japan: Horonobe URL | |||||||
| Coordinates | Lat. (o) | 45.045278 | Long. (o) | 141.859444 | Alt. (m) | Depth (m) | 140 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026446 | Metagenome / Metatranscriptome | 198 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0246099_10052513 | F026446 | N/A | MKVTGETFSLLKKKKRRRGKILKISKLSGKRTVTGQNSGELL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |