


| Basic Information | |
|---|---|
| Taxon OID | 3300029821 Open in IMG/M |
| Scaffold ID | Ga0246092_1007397 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig3392 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, Berkeley |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4649 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Japan: Horonobe URL | |||||||
| Coordinates | Lat. (o) | 45.045278 | Long. (o) | 141.859444 | Alt. (m) | Depth (m) | 215 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010068 | Metagenome / Metatranscriptome | 309 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0246092_10073974 | F010068 | AGGAGG | MKIKGTFYVTTKTAMTAAFGEERWNSFMAKLSEKDNYFKNVIMSITLIPVEKLIVIFDEMCKEFFNGDYSQYMMFGKVGAKVALSPEGPYKSYLLSKDLKQFVDFALPKLWATYFDGGVCTTKLENNIVHFKVTGVQFKHYYFEQLLMGYFQQSLKVFGKKSVAKQVRGISSGDEDIYFQYALKDS |
| ⦗Top⦘ |