


| Basic Information | |
|---|---|
| Taxon OID | 3300029787 Open in IMG/M |
| Scaffold ID | Ga0183757_1030837 Open in IMG/M |
| Source Dataset Name | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1128 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mediterranean Sea: TARA_018 | |||||||
| Coordinates | Lat. (o) | 35.7528 | Long. (o) | 14.2765 | Alt. (m) | Depth (m) | 60 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F087890 | Metagenome | 110 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0183757_10308371 | F087890 | N/A | MKKFLKDKSGPIMVGIGAILLVSDLMGVEGAITFAVGIILI |
| ⦗Top⦘ |