


| Basic Information | |
|---|---|
| Taxon OID | 3300029673 Open in IMG/M |
| Scaffold ID | Ga0307355_114017 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Trp2 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 928 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 44.11 | Long. (o) | -88.23 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004383 | Metagenome / Metatranscriptome | 440 | Y |
| F075034 | Metagenome / Metatranscriptome | 119 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307355_1140171 | F075034 | N/A | EHAAREVGLPGRADRMIACRSCGAPTAGSDGICRDCADAMRAERSEALSALCRVHRVRYVEDLPVSALEEMQVEWGRR |
| Ga0307355_1140173 | F004383 | AGGCGG | LHAGRYPEGAREYAREWVGMTDILERAFMARIRADEYREALAALQREFDERPDVIEIKRLIDRCEEERRTCIEQAKAAGISKQGSFLLKIRTRKQRTVIPDKFFARFGAETFVRCSTVAIGKAEAVVGKGAFDDCCEVEVKEIGVSVEYERSEGSE |
| ⦗Top⦘ |