NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0183748_1004301

Scaffold Ga0183748_1004301


Overview

Basic Information
Taxon OID3300029319 Open in IMG/M
Scaffold IDGa0183748_1004301 Open in IMG/M
Source Dataset NameMarine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7098
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameRed Sea: TARA_032
CoordinatesLat. (o)23.36Long. (o)37.2183Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001377Metagenome / Metatranscriptome711Y

Sequences

Protein IDFamilyRBSSequence
Ga0183748_10043016F001377N/AMLSNWLFWAIPREYIRAYMLTFWLVMFFLPGYIFGLHFTKLGFIINWIWFDLIFYGWVRSKQMLGDDE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.