


| Basic Information | |
|---|---|
| Taxon OID | 3300029314 Open in IMG/M |
| Scaffold ID | Ga0239302_103076 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial communities from Sewage Treatment Plant in Aalborg, Denmark - MBR_Gel1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Aalborg University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6217 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (72.73%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Comammox Microbial Communities From Various Environments And Locations In Europe |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Denmark: Aalberg | |||||||
| Coordinates | Lat. (o) | 57.049957 | Long. (o) | 9.865377 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054974 | Metagenome | 139 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0239302_1030766 | F054974 | GAG | MNTTRWNPSRLIVGTVLVLVAALLFLFGDGNFSTAGIVAIAVLGLISIAISRKT |
| ⦗Top⦘ |