


| Basic Information | |
|---|---|
| Taxon OID | 3300029314 Open in IMG/M |
| Scaffold ID | Ga0239302_100582 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial communities from Sewage Treatment Plant in Aalborg, Denmark - MBR_Gel1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Aalborg University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 26490 |
| Total Scaffold Genes | 33 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 22 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Comammox Microbial Communities From Various Environments And Locations In Europe |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Denmark: Aalberg | |||||||
| Coordinates | Lat. (o) | 57.049957 | Long. (o) | 9.865377 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006745 | Metagenome | 365 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0239302_10058227 | F006745 | N/A | MRTSQRDTRASSAVAVYVIILVAFQVFLLTVAVEAFATDDESLAWATAGVSIALAAGSAVLLRYLRP |
| ⦗Top⦘ |