NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0135211_1021694

Scaffold Ga0135211_1021694


Overview

Basic Information
Taxon OID3300029293 Open in IMG/M
Scaffold IDGa0135211_1021694 Open in IMG/M
Source Dataset NameMarine harbor viral communities from the Indian Ocean - SCH2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMichigan State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)721
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor → Marine Harbor Viral Communities From The Pacific And Indian Ocean

Source Dataset Sampling Location
Location NameIndian Ocean
CoordinatesLat. (o)1.26600833Long. (o)103.8333333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082690Metagenome113N

Sequences

Protein IDFamilyRBSSequence
Ga0135211_10216941F082690AGTAGMSKECVMCGGDAGEYGNNPAPLFNEGVCCDDCNQEVVMTRILINRVGRNMEQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.