


| Basic Information | |
|---|---|
| Taxon OID | 3300029199 Open in IMG/M |
| Scaffold ID | Ga0168647_101494 Open in IMG/M |
| Source Dataset Name | Deep subsurface microbial communities from shale gas basins in Pennsylvania, USA - 1_Day0 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7451 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 12 (85.71%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Shale Gas Basins In Pennsylvania, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Pennsylvania | |||||||
| Coordinates | Lat. (o) | 39.898 | Long. (o) | -79.976 | Alt. (m) | Depth (m) | 2517 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F048175 | Metagenome / Metatranscriptome | 148 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0168647_1014946 | F048175 | GAGG | MASGSFQFRYNHSNENAAWHTNPDAKFILPKEDVDIICDDPYLNENQFLEMVRRFFIACGYTEKQWKNALKEHLEEVEKTE |
| ⦗Top⦘ |