NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247609_11549757

Scaffold Ga0247609_11549757


Overview

Basic Information
Taxon OID3300028888 Open in IMG/M
Scaffold IDGa0247609_11549757 Open in IMG/M
Source Dataset NameSheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1728 DNA GHGlow gp2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)647
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameNew Zealand: Palmerston North, Manawatu-Wanganui
CoordinatesLat. (o)-40.3794Long. (o)175.6106Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016102Metagenome / Metatranscriptome249Y

Sequences

Protein IDFamilyRBSSequence
Ga0247609_115497571F016102N/AMSKIEYRKINFPKINWTEEDPQESTPELSQEIYNSLKDVLDTITNNKSINPHLIQDGLRSINFHKEKPEIYKIIEEMCLEYDLKGKEMNTMEILNYIMNSLSDIKTRKGLNSLFDEIKDKRTGEITPKELAQISKDNEENLDEKDFQFILKTIAGNSDSININQDEFYYIMTKSPEEALKITLATKNSKIK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.