NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307310_10074873

Scaffold Ga0307310_10074873


Overview

Basic Information
Taxon OID3300028824 Open in IMG/M
Scaffold IDGa0307310_10074873 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1463
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F000805Metagenome / Metatranscriptome883Y
F001079Metagenome / Metatranscriptome785Y

Sequences

Protein IDFamilyRBSSequence
Ga0307310_100748731F000805N/ASGAMGMPSGDTPAKAQAYYHYLQAHQQTMQHPDTWHVRWVDLAWLWGFVAVLCVVTLLWIWQYRTTRQRTGIYPVDRFGGYTTELAGPATFFFLLLTVILTAFAVVLILGHIIWGQKF
Ga0307310_100748732F001079AGAAGMAAAVPSALPYVAWSSVTFAEIPAESWEEVYGSMQALKAHVQEYPGCQKFEAFVEAAPRGSVRVHCYTTWDTPEQLEAYLDRGYTFTRMLGDVAGLAAEPTRVMEKVF
Ga0307310_100748733F000280AGAAGGMADEPQQRPARPLFGYRDVGEDDPRHSREAHIRAWVILGVIAAVYLVWTLIVFFFEPGLR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.