


| Basic Information | |
|---|---|
| Taxon OID | 3300028675 Open in IMG/M |
| Scaffold ID | Ga0272445_1017451 Open in IMG/M |
| Source Dataset Name | Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-003-1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2665 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (42.86%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Hyperthermophilic Archaeal Virus 1 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.5775 | Long. (o) | -110.7896 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000750 | Metagenome / Metatranscriptome | 908 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0272445_10174516 | F000750 | GGAG | MYLSVIITAFLFSYWFFRKKFRARTLSLPINVETGDIIHGAFGSLLANLSLHGMYVDVMVGVLLYLAYQFAGFLRKHDTIDKDIATFVAGYFGTIIVGGIPL |
| ⦗Top⦘ |