


| Basic Information | |
|---|---|
| Taxon OID | 3300028663 Open in IMG/M |
| Scaffold ID | Ga0309993_1506 Open in IMG/M |
| Source Dataset Name | Enriched hypersaline water microbial communities from Club Lake, Antarctica - Round 1 Nha-Ce |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Garvan Institute of Medical Research |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4718 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Antarctic Nanohaloarchaea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Club Lake, Antarctica | |||||||
| Coordinates | Lat. (o) | -68.5417 | Long. (o) | 78.2467 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003128 | Metagenome | 506 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0309993_15061 | F003128 | N/A | RRRGTLRMQIEVSASEIKAAKKADDRGRVTLGSEYAGKAVTVAVLEVEDE |
| ⦗Top⦘ |