


| Basic Information | |
|---|---|
| Taxon OID | 3300028653 Open in IMG/M |
| Scaffold ID | Ga0265323_10000137 Open in IMG/M |
| Source Dataset Name | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 42245 |
| Total Scaffold Genes | 37 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 28 (75.68%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Carex Aquatilis Grown In University Of Washington, Seatle, Wa, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Seattle, Washington | |||||||
| Coordinates | Lat. (o) | 47.6516 | Long. (o) | -122.3045 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044612 | Metagenome | 154 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0265323_100001372 | F044612 | GGAG | LNALDLVPRGFALLVIQLRGRRTNQPPLHTAHNRHHHFQIAQQFGAGPGGNFLLRLTLRFEKQLGIIQNAFADCG |
| ⦗Top⦘ |