


| Basic Information | |
|---|---|
| Taxon OID | 3300028624 Open in IMG/M |
| Scaffold ID | Ga0302246_1051580 Open in IMG/M |
| Source Dataset Name | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Trp |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1018 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 44.11 | Long. (o) | -88.23 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029451 | Metagenome / Metatranscriptome | 188 | N |
| F054066 | Metagenome / Metatranscriptome | 140 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0302246_10515802 | F054066 | AGG | MFGMSRKPKELNRFRVGKGSPGLKAVMYRMANKSYLDIRIYRGYREVTRIVTPDTGMKRFVVEGVGAFVMPNEEQMLRQLHDRHALYIPYNINSSAPGEVTEELEPVAFVYPPLSPAEFQTELEAQTVADLLAETEKDMSWIWLLAGGAVLIFVLILLFGGA |
| Ga0302246_10515803 | F029451 | GGAGG | MAVDFEDLIASTSSTAGKPSIIEALLSTVDAIFTNNRMLQRSRLSSRNIRGVVRVIGSQAFLRARLERSYKPFLDPDSGEFTYSRYDNRVLTAVCEGALSGRISLDGKSRDEII |
| ⦗Top⦘ |