


| Basic Information | |
|---|---|
| Taxon OID | 3300028602 Open in IMG/M |
| Scaffold ID | Ga0265294_10309515 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1047 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Waterloo, Ontario | |||||||
| Coordinates | Lat. (o) | 43.442 | Long. (o) | -80.577 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009968 | Metagenome / Metatranscriptome | 310 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0265294_103095153 | F009968 | AGGA | VEYEEPAQVPDGERVRPSTCTGCRSHYQERHWWIFELDFCGLSGDVVGFECPLGCIDTAGCPTYERRTAWPEGAVA |
| ⦗Top⦘ |