NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255345_1295129

Scaffold Ga0255345_1295129


Overview

Basic Information
Taxon OID3300028568 Open in IMG/M
Scaffold IDGa0255345_1295129 Open in IMG/M
Source Dataset NameWastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyRestricted
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).


Scaffold Components
Scaffold Length (bps)590
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location NameCanada: Vancouver, British Columbia
CoordinatesLat. (o)49.1150727Long. (o)-123.147Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047698Metagenome / Metatranscriptome149N

Sequences

Protein IDFamilyRBSSequence
Ga0255345_12951291F047698N/AVVQMQQATAIVGVLIGFLILTQIGIFVCDAMIEASSVNESSDLYDAQTEAIQTFTQCLSIVRILLIVAIVAVVFQYLQGAGLIPGFGGPRQGGY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.