


| Basic Information | |
|---|---|
| Taxon OID | 3300027986 Open in IMG/M |
| Scaffold ID | Ga0209168_10112414 Open in IMG/M |
| Source Dataset Name | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1400 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Pennsylvania, Centralia | |||||||
| Coordinates | Lat. (o) | 40.7999 | Long. (o) | -76.3402 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005465 | Metagenome / Metatranscriptome | 400 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209168_101124141 | F005465 | GGA | MHPKVDRFIRRQNVERYRRLLERVTAESDRQKIFNLLAERAAKAKRR |
| ⦗Top⦘ |