


| Basic Information | |
|---|---|
| Taxon OID | 3300027980 Open in IMG/M |
| Scaffold ID | Ga0209475_10114205 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1291 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Coast | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008497 | Metagenome / Metatranscriptome | 332 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209475_101142051 | F008497 | N/A | ELIPEELMKTYGIPQYDEEGIQNGVIKPTFKELGEYNRRKFGASPVVKIGKAKYHIIELEASWVNGELSALLDLGKGKEYPNNCLMTRTEAAKFIRDNSDDSII |
| ⦗Top⦘ |