


| Basic Information | |
|---|---|
| Taxon OID | 3300027976 Open in IMG/M |
| Scaffold ID | Ga0209702_10071472 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1776 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Fryxell, Antarctica | |||||||
| Coordinates | Lat. (o) | -77.605 | Long. (o) | 163.163 | Alt. (m) | Depth (m) | 18 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031375 | Metagenome | 182 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209702_100714721 | F031375 | N/A | MTLQITLNGSVIDLALFDYSLAIAHGRSDVTSSPTASNAQLVLRGDTGPLLDLADTVAISFDGVARFTGAISDLNVSFISTTNPTAITTITAMGNLAKLGYTDVGATGYIEQSARQRVTGILDATGLDYLNA |
| ⦗Top⦘ |