| Basic Information | |
|---|---|
| Taxon OID | 3300027898 Open in IMG/M |
| Scaffold ID | Ga0209067_10004319 Open in IMG/M |
| Source Dataset Name | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8021 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (100.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pennsylvania, USA | |||||||
| Coordinates | Lat. (o) | 41.1289 | Long. (o) | -78.4195 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001032 | Metagenome / Metatranscriptome | 800 | Y |
| F001745 | Metagenome / Metatranscriptome | 643 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209067_100043193 | F001032 | GGA | MGLGGVDTLHGKRNCRVDSCGSGAITSLDRQALCLNHFLLRCYERLEGLDPRGRRFTAEPVDLASMRAFIEECSRKALDVSLQSQNLSNLQRGRLLDILLWAGELFLLLRIPRLTLAQSMASSEDHRLAAHVASPNF |
| Ga0209067_100043194 | F001745 | AGGA | VQAAIPAALASALKDVNGFAGCLVMISDQEARLVTVVTLWAGNDRAKCCTQNTRWVHALLKPYLDRCLRVQTMVAHLPVLPMLDFLPAMRSETNASEECSMMQGHISEDETVCVA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |