


| Basic Information | |
|---|---|
| Taxon OID | 3300027854 Open in IMG/M |
| Scaffold ID | Ga0209517_10028312 Open in IMG/M |
| Source Dataset Name | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4807 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Weissenstadt | |||||||
| Coordinates | Lat. (o) | 50.13 | Long. (o) | 11.88 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038574 | Metagenome / Metatranscriptome | 165 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209517_100283125 | F038574 | AGG | MATFDPFPALVCKYCSVPIPLPPAKRPDKFEGQGLWPEGGSRRNFLCPACRHVHGYSAPDVQLILPHTDPRRAGKSYNVVYIRLQCRAQGCASILRIRTLMAFDKCPQEKAPGMLASSQAHAIACGNGHILSGPIVLFGLAFDARFDEDWEIGEGWNRRTLPRWCA |
| ⦗Top⦘ |