


| Basic Information | |
|---|---|
| Taxon OID | 3300027807 Open in IMG/M |
| Scaffold ID | Ga0209208_10052497 Open in IMG/M |
| Source Dataset Name | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3476 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (42.86%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Minnesota | |||||||
| Coordinates | Lat. (o) | 47.5028 | Long. (o) | -93.4828 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F035157 | Metagenome / Metatranscriptome | 172 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209208_100524975 | F035157 | N/A | VQLKATRQLKEIIEQLAKAKKAREFGRSDRDLKALELKLAECQSVVDEVGDPPLKFLKATEQVKLVPNTTHRLGQGGIPDLKVAFVSTLPLLHFFLTKIRIKSMLSFCRVSVESNKTIFEIFAMRIALQR |
| ⦗Top⦘ |