


| Basic Information | |
|---|---|
| Taxon OID | 3300027765 Open in IMG/M |
| Scaffold ID | Ga0209073_10000609 Open in IMG/M |
| Source Dataset Name | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6629 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (18.18%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 33.8834 | Long. (o) | -83.4195 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007286 | Metagenome / Metatranscriptome | 354 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209073_100006096 | F007286 | N/A | MDKFQEMGQRLDEELTRLRRFVDEELAPETEKRTAQFLREVSEKLTDAAGWLEARGAARNVRKEGTS |
| ⦗Top⦘ |