


| Basic Information | |
|---|---|
| Taxon OID | 3300027745 Open in IMG/M |
| Scaffold ID | Ga0209908_10082321 Open in IMG/M |
| Source Dataset Name | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 770 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Kiruna | |||||||
| Coordinates | Lat. (o) | 68.3534 | Long. (o) | 19.0473 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016294 | Metagenome / Metatranscriptome | 248 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209908_100823211 | F016294 | AGGAG | MNVRKHLTIGLALTGLALGLTTVKANAQSGLNGTFELPEATFWGNTLLQPGRYTISMRTEASDISRVPVIHLSGEGVNAAFLAIATPAHESGRNYLDIANIGGTYVIRAFDSGLLGESFSFGVTKSVKNKALRAST |
| ⦗Top⦘ |