


| Basic Information | |
|---|---|
| Taxon OID | 3300027724 Open in IMG/M |
| Scaffold ID | Ga0209582_1061842 Open in IMG/M |
| Source Dataset Name | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1314 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Austria: Klosterneuburg | |||||||
| Coordinates | Lat. (o) | 48.3 | Long. (o) | 16.2 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019998 | Metagenome / Metatranscriptome | 226 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209582_10618422 | F019998 | N/A | VAALAGASSITLTDAVEYIAGDYIGIATDSNGLMWYKVNSVVGQIVNLYEVGTTTAASLDYAASVDAIVVGFTTLAWQPLRVIEARRVDLSSDIEVPLMIVGKFDYERIPNKAMTSIPLWLYAQTKIAETQVFVWPPTAYANWAIGYSFERRYQDVDAGVNSMDFPPEAYESLRYGLAARLGDEFPIDPQRQAMLEQKAAGYFTAMRQASSGNASVKFGVRG |
| ⦗Top⦘ |