NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208990_1001784

Scaffold Ga0208990_1001784


Overview

Basic Information
Taxon OID3300027663 Open in IMG/M
Scaffold IDGa0208990_1001784 Open in IMG/M
Source Dataset NameForest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6488
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameEl Dorado National Forest, Georgetown, California, USA
CoordinatesLat. (o)38.88Long. (o)-120.64Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000833Metagenome / Metatranscriptome871Y

Sequences

Protein IDFamilyRBSSequence
Ga0208990_10017843F000833GGAGMSQSAFRSAVCCLLAILFPAQVMLAGETASAMLYTNGAAWLNGSEVPKSAAVFSGDMLQTRPDSTASIQSNGSSVMVLADSLVKFEGPAVELEHGAVRVTTSRGLAARAGDVTVKPAANTWTEFQVTDVDGRVQIAANKGDLTVQDDKGTTTVTQGQQTTRDDTTDTEKKKKKHRRGAGAATAAGGGIMSSTPVVYGGLAALGVAAIWIWTRSEPPVSPACPTNPCQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.