NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207422_1000165

Scaffold Ga0207422_1000165


Overview

Basic Information
Taxon OID3300027607 Open in IMG/M
Scaffold IDGa0207422_1000165 Open in IMG/M
Source Dataset NameMarine cyanobacterial communities from Panama - species 1 Leptolyngbya sp. (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)255941
Total Scaffold Genes249 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)206 (82.73%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Cyanobacterial Communities From Panama, Similar To Oscillatoria Species

Source Dataset Sampling Location
Location NamePanama: Panama City
CoordinatesLat. (o)9.28Long. (o)-79.97Alt. (m)Depth (m)48.85
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008191Metagenome / Metatranscriptome337Y

Sequences

Protein IDFamilyRBSSequence
Ga0207422_1000165241F008191GGAGMTARLTCADCRWWHFQSTETAASRDDEQAVGYCRRMPPERRENGVGAWPITFPTDWCGEYVHKDDVSYQIGEGFTAVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.