


| Basic Information | |
|---|---|
| Taxon OID | 3300027600 Open in IMG/M |
| Scaffold ID | Ga0255117_1026202 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1277 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New York | |||||||
| Coordinates | Lat. (o) | 45.0061 | Long. (o) | -74.7949 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042160 | Metagenome | 158 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255117_10262021 | F042160 | N/A | DKDSYMMCYPNGLAVCKVWTTKVGGANNDQLEFCFRTPHYAKSRGSDQNDRETIRSTKLSSLMAVLKRQEVVRDKKIIMDSKVKQVKLGVSTLRRAMGTSDKQNAFTADEIHVMLATLLGESTDGIIPVLDLNKCKNTLDIYKEADRIRDIKREESKRFFKNPFYLIGIDDYKHLLIGKFKMTILHSDTTKIEYEIIEDFKRVKTIEEYPELVPLMTMMKVSYETKECRRLGVLNFPIMDGYDEGLDATFFYGSQPTNYEQAWMATPCPI |
| ⦗Top⦘ |