NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209428_1297279

Scaffold Ga0209428_1297279


Overview

Basic Information
Taxon OID3300027564 Open in IMG/M
Scaffold IDGa0209428_1297279 Open in IMG/M
Source Dataset NameOlavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)736
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameZanca-sant'andrea, Tuscany, Italy
CoordinatesLat. (o)42.8072Long. (o)10.1411Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007457Metagenome351Y

Sequences

Protein IDFamilyRBSSequence
Ga0209428_12972791F007457N/AAHSPSAGTAESQMPLPLSWGIGRAATLLKTLLQYFGKSLETLPGVAYPGFGDNRSTLNTKTG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.