


| Basic Information | |
|---|---|
| Taxon OID | 3300027318 Open in IMG/M |
| Scaffold ID | Ga0209365_1098238 Open in IMG/M |
| Source Dataset Name | Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius imperfectus BELIZE.2 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1364 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Marburg | |||||||
| Coordinates | Lat. (o) | 50.8 | Long. (o) | 8.81 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007406 | Metagenome | 351 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209365_10982381 | F007406 | N/A | MSLFFYLFTIVINLWHQKFVISDVIAVFVNKQDGIQRQGHDFDKTFVFKKVHSKKVDKRTTXKQLDKAWC |
| ⦗Top⦘ |