


| Basic Information | |
|---|---|
| Taxon OID | 3300027179 Open in IMG/M |
| Scaffold ID | Ga0208955_100731 Open in IMG/M |
| Source Dataset Name | Bulk soil microbial communities from Harvard Forest, USA - 2Bulk_unsorted metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 513 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Bulk Soil → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Harvard Forest, Massachusetts, USA | |||||||
| Coordinates | Lat. (o) | 42.5502 | Long. (o) | -72.1737 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F081919 | Metagenome / Metatranscriptome | 114 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208955_1007311 | F081919 | AGGA | MAAPGVAEEVQKGAGAYWRDLVFSRLVPALFFSIFLARQLLFLWDGIHSVHHPSDYLFVLQQGLALAYFTMLVVLYSTRLPKRGTDHRAAVVF |
| ⦗Top⦘ |