


| Basic Information | |
|---|---|
| Taxon OID | 3300027081 Open in IMG/M |
| Scaffold ID | Ga0208954_1024426 Open in IMG/M |
| Source Dataset Name | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C33A6_35 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 807 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Monterey Bay, California, USA | |||||||
| Coordinates | Lat. (o) | 36.25 | Long. (o) | -122.2099 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017120 | Metagenome / Metatranscriptome | 242 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208954_10244262 | F017120 | N/A | NKDLVVMSLNTFVNNTAMWEAFISELDERISTQQRSMETVTDTAELYRHQGAIRALRQLQYLRDKVNG |
| ⦗Top⦘ |