NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209648_10639341

Scaffold Ga0209648_10639341


Overview

Basic Information
Taxon OID3300026551 Open in IMG/M
Scaffold IDGa0209648_10639341 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)583
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000405Metagenome / Metatranscriptome1176Y

Sequences

Protein IDFamilyRBSSequence
Ga0209648_106393411F000405N/AKVLIEVWCDWDPEDSDLEEMVRHVLLGEDSICTLQEVVKVVDRPQDIDNEEAMSFFGGQEGDAEQSQG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.