| Basic Information | |
|---|---|
| Taxon OID | 3300026467 Open in IMG/M |
| Scaffold ID | Ga0257154_1002474 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2237 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From H.J. Andrews Experimental Forest, Oregon, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oregon | |||||||
| Coordinates | Lat. (o) | 44.23 | Long. (o) | -122.22 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000269 | Metagenome / Metatranscriptome | 1410 | Y |
| F000323 | Metagenome / Metatranscriptome | 1300 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0257154_10024741 | F000269 | GAG | MKPTDLPATVIAHLPLPQATGSQMLLQKENGKQYLYVQQATKQGFIVVDVSKPEKPSLLKRTAESNQATTGNMEMVSPDVAIAEAPEKTPATLTSSSHPTETVRVLDLSDPRNPKTLETFTKVSGLLPDGGHSLMYLTNNEGLWILRYNHPSLLEPAKKKPACDSNSEIMAMPPDCD |
| Ga0257154_10024742 | F000323 | GAGG | MKTFLCALLLSGSFLLAQDSYPASTGQHDAKDSKGQVTVQGCVGRSSGDYVLTKQNPAMTYELQGTHKIRLRNYLGQRVEVTGSESPTMSTSSDAMNKTGSAAPVTLTVTSIRTIDKECTVRQPSAQ |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |