


| Basic Information | |
|---|---|
| Taxon OID | 3300026439 Open in IMG/M |
| Scaffold ID | Ga0256361_1082946 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepB_8d (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 535 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Louisiana | |||||||
| Coordinates | Lat. (o) | 29.8571 | Long. (o) | -89.9778 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F101271 | Metagenome / Metatranscriptome | 102 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256361_10829462 | F101271 | N/A | ALAGRDWAKLQQSIHALQQAMQHISSFPGGAEGVRKQLLASEGTARETADHLIERVMIERRSSAELIRLQLQRLQALQTMTSFEEDTGLYSETGATKGRGGRLSTWV |
| ⦗Top⦘ |