


| Basic Information | |
|---|---|
| Taxon OID | 3300026286 Open in IMG/M |
| Scaffold ID | Ga0209460_1000510 Open in IMG/M |
| Source Dataset Name | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 2_5/13/2013_ DNA (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 34749 |
| Total Scaffold Genes | 30 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 27 (90.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Madison, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 43.076217 | Long. (o) | -89.411742 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007648 | Metagenome | 347 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209460_10005104 | F007648 | GAGG | MAVHITPEQEIWVMTPEGAELTGYSREYLERLAYKNLRLPDDERLIKTRKRVGRYEMWLPDLLRYIDEIGYGPHQNKK |
| ⦗Top⦘ |